missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C21orf58 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 540.75€
Especificaciones
| Antígeno | C21orf58 |
|---|---|
| Aplicaciones | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18106897
|
Novus Biologicals
NBP2-47531 |
0.1 mL |
 572.00€ 540.75€ / 0.10 ml Ahorro 31.25€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18608755
|
Novus Biologicals
NBP2-47531-25ul |
25 μL |
415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
C21orf58 Polyclonal specifically detects C21orf58 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Especificaciones
| C21orf58 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AA82526610hypothetical protein LOC54058, chromosome 21 open reading frame 58, spliced ESTs Z25278 | |
| C21orf58 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 54058 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPASNRTREGGGLWP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto