missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. C1qR1/CD93 Antibody, Novus Biologicals™

C1qR1/CD93 Antibody, Novus Biologicals™

Código de producto. 18431531 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Artikelnummer. Cantidad unitSize
18431531 25 μL 25 microlitros
18239476 0.1 mL 0.10 ml
2 options
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18431531

Brand: Novus Biologicals NBP18831625ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

C1qR1/CD93 Polyclonal specifically detects C1qR1/CD93 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antígeno C1qR1/CD93
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen C1q receptor 1, C1q/MBL/SPA receptor, C1qR(P), C1qRp, CD93 antigenC1qR, CD93 molecule, CDw93C1QR1, Complement component 1 q subcomponent receptor 1, complement component 1, q subcomponent, receptor 1, complement component C1q receptor, dJ737E23.1, ECSM3, Matrix-remodeling-associated protein 4, matrix-remodelling associated 4, MXRA4
Símbolos de los genes CD93
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFS
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 22918
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.