missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BTLA/CD272 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-49354-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
BTLA/CD272 Polyclonal antibody specifically detects BTLA/CD272 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| BTLA/CD272 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| B and T lymphocyte associated, B and T lymphocyte attenuator, B- and T-lymphocyte attenuator, B- and T-lymphocyte-associated protein, BTLA1, CD272, CD272 antigen, FLJ16065, MGC129743 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE | |
| 25 μL | |
| Cell Cycle and Replication, Phospho Specific | |
| 151888 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
BTLA/CD272 Antibody, Novus Biologicals™ > 25 μL, Unconjugated
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido