missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ BMP7 Recombinant Protein
Human full-length ORF recombinant protein with GST-tag at N-terminal.
335.00€ - 508.00€
Especificaciones
| Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
|---|---|
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Peso molecular | 73.15 |
| Intervalo de pH | 8 |
| Método de preparación | In vitro wheat germ expression system |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16172291
|
Abnova™
H00000655-P01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 30-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16182291
|
Abnova™
H00000655-P01.25UG |
25μg |
508.00€
25 microgramos |
Fecha estimada de envío: 30-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
- Bone morphogenetic proteins (BMPs) belongs to family of secreted signaling molecules
- Induces ectopic bone growth
- Molecular weight: 73.15kDa
- Preparation method:in vitro wheat germ expression system
- Purification: glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in the elution buffer
Sequence: MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNE
TFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Best when used within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 73.15 | |
| In vitro wheat germ expression system | |
| Wheat Germ (in vitro) | |
| Recombinant |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Human | |
| Solution |