missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Western-Blot-NBP2-61628-img0010.jpg-650.jpg)
-Western-Blot-NBP2-61628-img0009.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP2-61628-img0008.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP2-61628-img0007.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP2-61628-img0006.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP2-61628-img0005.jpg-650.jpg)
-Immunohistochemistry-NBP2-61628-img0004.jpg-650.jpg)
-Immunohistochemistry-NBP2-61628-img0003.jpg-650.jpg)
-Immunohistochemistry-NBP2-61628-img0002.jpg-650.jpg)
-Immunohistochemistry-NBP2-61628-img0001.jpg-650.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-61628-img0011.jpg-650.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-61628-img0012.jpg-650.jpg)
beta-Catenin Antibody (CL3689), Novus Biologicals™
Mouse Monoclonal Antibody
Marca: Novus Biologicals NBP2-61628
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
beta-Catenin Monoclonal specifically detects beta-Catenin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| beta-Catenin | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CTNNB1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG2a |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| CL3689 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:20000 - 1:50000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:20000 - 1:50000 | |
| beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923 | |
| Mouse | |
| Protein A purified | |
| Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Immune System Diseases, Mucosal Immunology, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway, Wnt Signaling Pathway | |
| 1499 | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido