missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. BAP28 Antibody, Novus Biologicals™

BAP28 Antibody, Novus Biologicals™

Produktkod. p-200083455 Handla allt< titel> Produkter
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Cantidad:
25 μL
100 μL
Förpackningsstorlek
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Cantidad unitSize
18289491 100 μL 100 microlitros
18684907 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18289491 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP256942

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

BAP28 Polyclonal specifically detects BAP28 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifikationer

Antígeno BAP28
Aplicaciones Immunocytochemistry, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen BAP28HEAT repeat-containing protein 1, EC 4.1.1.31, EC 6.3.4.4, FLJ10359, HEAT repeat containing 1, MGC72083, Protein BAP28
Símbolos de los genes HEATR1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YDVSPLLHYMLPHLVVSIIHHVTGEETEGMDGQIYKRHLEAILTKISLKNNLDHLLASLLFEEYISYSSQEEMDSNKVSLLNEQFLPLIRLLESKYPRT
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Immunology, Innate Immunity
Primario o secundario Primary
ID de gen (Entrez) 55127
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.