missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BACH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Especificaciones
| Antígeno | BACH2 |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18224493
|
Novus Biologicals
NBP2-58464 |
100 μL |
624.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18638887
|
Novus Biologicals
NBP2-58464-25ul |
25 μL |
280.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
BACH2 Polyclonal specifically detects BACH2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| BACH2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 60468 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| BTB and CNC homolog 2, BTB and CNC homology 1, basic leucine zipper transcription factor 2, transcription regulator protein BACH2 | |
| BACH2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto