BACH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca: Novus Biologicals NBP2-58464-25ul

Ver más versiones de este producto

Código de producto. 18638887

280.00€ / 25 microlitros

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Description

BACH2 Polyclonal specifically detects BACH2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antígeno	BACH2
Clasificación	Polyclonal
Dilución	Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Alias de gen	BTB and CNC homolog 2, BTB and CNC homology 1, basic leucine zipper transcription factor 2, transcription regulator protein BACH2
Especie del huésped	Rabbit
Método de purificación	Affinity Purified
Estado normativo	RUO
ID de gen (Entrez)	60468
Especies diana	Human
Isotype	IgG

Aplicaciones	Immunocytochemistry, Immunofluorescence
Conjugado	Unconjugated
Formulación	PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Símbolos de los genes	BACH2
Inmunógeno	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK
Cantidad	25 μL
Primario o secundario	Primary
Especificidad de la prueba	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenido y almacenamiento	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

BACH2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions