missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. B7-H2/ICOSLG Antibody, Novus Biologicals™

B7-H2/ICOSLG Antibody, Novus Biologicals™

Código de producto. p-200060559 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
Código de producto. Cantidad unitSize
18607176 25 μL 25 microlitros
18619907 100 μg 100 microlitros
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18607176

Marca: Novus Biologicals NBP26860625ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

B7-H2/ICOSLG Polyclonal antibody specifically detects B7-H2/ICOSLG in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno B7-H2/ICOSLG
Aplicaciones Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen B7H2B7 homolog 2, B7-H2B7-related protein 1, B7RP1B7-like protein Gl50, B7RP-1LICOS, CD275, CD275 antigen, GL50transmembrane protein B7-H2 ICOS ligand, ICOSL, ICOS-L, inducible T-cell co-stimulator ligand, KIAA0653ICOS ligand
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT
Método de purificación Protein A purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cell Cycle and Replication
Primario o secundario Primary
ID de gen (Entrez) 23308
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.