missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATPase Na+/K+ beta 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
463.00€
Especificaciones
| Antígeno | ATPase Na+/K+ beta 2 |
|---|---|
| Dilución | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18300977
|
Novus Biologicals
NBP3-10586-100UL |
100 μg |
463.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
ATPase Na+/K+ beta 2 Polyclonal specifically detects ATPase Na+/K+ beta 2 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Frozen.Especificaciones
| ATPase Na+/K+ beta 2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen) | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| adhesion molecule on glia, AMOGsodium/potassium-dependent ATPase beta-2 subunit, ATPase, Na+/K+ transporting, beta 2 polypeptide, Na, K-ATPase beta-2 polypeptide, Sodium/potassium-dependent ATPase subunit beta-2, sodium/potassium-transporting ATPase beta-2 chain, sodium/potassium-transporting ATPase subunit beta-2 | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_038201). Peptide sequence WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 482 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto