missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATPase Na+/K+ beta 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
462.00€
Especificaciones
Antígeno | ATPase Na+/K+ beta 2 |
---|---|
Dilución | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen |
Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen) |
Clasificación | Polyclonal |
Conjugado | Unconjugated |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
18300977
|
Bio-Techne
NBP3-10586-100UL |
100 μg |
462.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
ATPase Na+/K+ beta 2 Polyclonal specifically detects ATPase Na+/K+ beta 2 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Frozen.Especificaciones
ATPase Na+/K+ beta 2 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen) | |
Unconjugated | |
Rabbit | |
Mouse | |
adhesion molecule on glia, AMOGsodium/potassium-dependent ATPase beta-2 subunit, ATPase, Na+/K+ transporting, beta 2 polypeptide, Na, K-ATPase beta-2 polypeptide, Sodium/potassium-dependent ATPase subunit beta-2, sodium/potassium-transporting ATPase beta-2 chain, sodium/potassium-transporting ATPase subunit beta-2 | |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_038201). Peptide sequence WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
482 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
ATPase Na+/K+ beta 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™