missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATPase Na+/K+ beta 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Bio-Techne NBP3-10586-100UL
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ATPase Na+/K+ beta 2 Polyclonal specifically detects ATPase Na+/K+ beta 2 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Frozen.
Especificaciones
| ATPase Na+/K+ beta 2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Frozen | |
| adhesion molecule on glia, AMOGsodium/potassium-dependent ATPase beta-2 subunit, ATPase, Na+/K+ transporting, beta 2 polypeptide, Na, K-ATPase beta-2 polypeptide, Sodium/potassium-dependent ATPase subunit beta-2, sodium/potassium-transporting ATPase beta-2 chain, sodium/potassium-transporting ATPase subunit beta-2 | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_038201). Peptide sequence WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Frozen) | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 482 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
ATPase Na+/K+ beta 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™ > 100 μg; Unconjugated
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido