missing translation for 'onlineSavingsMsg'
Learn More

ATP6V1E2 Antibody - Azide and BSA Free, Novus Biologicals™

Código de producto. 18635571 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18635571 0.02 mL 0.02 ml
18693441 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18635571 Proveedor Novus Biologicals N.º de proveedor NBP2920650.02ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
Ver productos alternativos

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

ATP6V1E2 Polyclonal antibody specifically detects ATP6V1E2 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno ATP6V1E2
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500-1:2000
Formulación PBS with 50% glycerol, pH7.3.
Alias de gen ATP6E1V-ATPase subunit E 2, ATP6EL2, ATP6V1EL2, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD-like 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2, MGC9341, Vacuolar proton pump subunit E 2, vacuolar-type proton-translocating ATPase subunit E1, VMA4, V-type proton ATPase subunit E 2
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human ATP6V1E2 (NP_542384.1). LISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Cancer, Endocrinology, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 90423
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.