missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1E2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-92065-0.02ml
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ATP6V1E2 Polyclonal antibody specifically detects ATP6V1E2 in Human, Mouse, Rat samples. It is validated for Western Blot
Especificaciones
| ATP6V1E2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| ATP6E1V-ATPase subunit E 2, ATP6EL2, ATP6V1EL2, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD-like 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2, MGC9341, Vacuolar proton pump subunit E 2, vacuolar-type proton-translocating ATPase subunit E1, VMA4, V-type proton ATPase subunit E 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human ATP6V1E2 (NP_542384.1). LISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG | |
| 0.02 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 90423 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido