missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ATP6V1B2 Antibody, Novus Biologicals™

ATP6V1B2 Antibody, Novus Biologicals™

Código de producto. 18288056 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18288056 0.1 mL 0.10 ml
18482461 25 μL 25 microlitros
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18288056

Marca: Novus Biologicals NBP188890

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

ATP6V1B2 Polyclonal specifically detects ATP6V1B2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno ATP6V1B2
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen 000 subunit, 56/58kD, isoform 2, ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2, Endomembrane proton pump 58 kDa subunit, H+ transporting two-sector ATPase, HO57ATP6B1B2, vacuolar H+-ATPase 56, Vacuolar proton pump subunit B 2, VATB, V-ATPase B2 subunit, V-ATPase subunit B 2, Vma2, VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2, V-type proton ATPase subunit B, brain isoform
Símbolos de los genes ATP6V1B2
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 526
Especificidad de la prueba Specificity of human ATP6V1B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.