missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V0A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-59949
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ATP6V0A1 Polyclonal specifically detects ATP6V0A1 in Human samples. It is validated for Western Blot.
Especificaciones
| ATP6V0A1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 535 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q93050 | |
| ATP6V0A1 | |
| Synthetic peptides corresponding to ATP6V0A1(ATPase, H+ transporting, lysosomal V0 subunit a1) The peptide sequence was selected from the N terminal of ATP6V0A1. Peptide sequence RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE. | |
| 100 μL | |
| Primary | |
| This product is specific to Subunit or Isoform: a isoform 1. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido