missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ATP6V0A1 Antibody, Novus Biologicals™

ATP6V0A1 Antibody, Novus Biologicals™

Product Code. p-200038212 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
25 μL
Unit Size:
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18434491 25 μL 25 microlitros
18716783 - -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18434491 Supplier Novus Biologicals Supplier No. NBP18934225ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 3 publications

ATP6V0A1 Polyclonal specifically detects ATP6V0A1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno ATP6V0A1
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1
Símbolos de los genes ATP6V0A1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 535
Especificidad de la prueba Specificity of human ATP6V0A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Mouse
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.