missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP13A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 748.65€
Especificaciones
| Antígeno | ATP13A2 |
|---|---|
| Dilución | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18682819
|
Novus Biologicals
NBP2-49149-25ul |
25 μL |
 415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18602847
|
Novus Biologicals
NBP2-49149 |
0.1 mL |
792.00€ 748.65€ / 0.10 ml Ahorro 43.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
ATP13A2 Polyclonal antibody specifically detects ATP13A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Especificaciones
| ATP13A2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Neurodegeneration, Neuroscience, Plasma Membrane Markers, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 23400 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ATPase type 13A2, EC 3.6.3, EC 3.6.3.-, EC 3.6.3.5, EC 3.6.3.8, FLJ26510, HSA9947, KRPPD, PARK9putative ATPase, Parkinson disease (autosomal recessive) 9 (Kufor-Rakeb syndrome), probable cation-transporting ATPase 13A2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIET | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto