missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP13A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-48985-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ATP13A2 Polyclonal antibody specifically detects ATP13A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| ATP13A2 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ATPase type 13A2, EC 3.6.3, EC 3.6.3.-, EC 3.6.3.5, EC 3.6.3.8, FLJ26510, HSA9947, KRPPD, PARK9putative ATPase, Parkinson disease (autosomal recessive) 9 (Kufor-Rakeb syndrome), probable cation-transporting ATPase 13A2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKV | |
| 25 μL | |
| Cancer, Neurodegeneration, Neuroscience, Plasma Membrane Markers, Signal Transduction | |
| 23400 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido