missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Ataxin-2-like protein Antibody, Novus Biologicals™

Ataxin-2-like protein Antibody, Novus Biologicals™

Product Code. 18668915 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Unit Size:
0.10 ml
25 microlitros
Product Code. Cantidad unitSize
18668915 0.1 mL 0.10 ml
18655797 25 μL 25 microlitros
2 options
This item is not returnable. View return policy

Product Code. 18668915

Brand: Novus Biologicals NBP248790

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Ataxin-2-like protein Polyclonal antibody specifically detects Ataxin-2-like protein in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Ataxin-2-like protein
Aplicaciones Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen A2DA2RP, A2LG, A2lp, ataxin 2 related protein, ataxin 2-like, Ataxin-2 domain protein, ataxin-2-like protein, Ataxin-2-related protein
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: LKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGED
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 11273
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.