missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ASAP1 Antibody, Novus Biologicals™

ASAP1 Antibody, Novus Biologicals™

Código de producto. 18669398 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Unit Size:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18669398 25 μL 25 microlitros
18651088 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18669398 Leverandør Novus Biologicals Leverandørnr. NBP24851925ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

ASAP1 Polyclonal antibody specifically detects ASAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antígeno ASAP1
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein, AMAP1, ARF GTPase-activating protein 1, arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1, ArfGAP with SH3 domain, ankyrin repeat and PH domain 1, centaurin, beta 4, CENTB4, DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1, development and differentiation enhancing factor 1, Development and differentiation-enhancing factor 1, Differentiation-enhancing factor 1, KIAA1249DEF-1, PAG2, PAP, PIP2-dependent ARF1 GAP, ZG14P
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: STPRDKQRLSYGAFTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKT
Método de purificación Immunogen affinity purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Phospho Specific
Primario o secundario Primary
ID de gen (Entrez) 50807
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.