missing translation for 'onlineSavingsMsg'
Learn More

Apolipoprotein L5 Antibody, Novus Biologicals™

Código de producto. p-200040368 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18464352 25 μL 25 microlitros
18059116 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18464352 Proveedor Novus Biologicals N.º de proveedor NBP19167525ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Apolipoprotein L5 Polyclonal specifically detects Apolipoprotein L5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antígeno Apolipoprotein L5
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen Q9BWW9
Alias de gen apolipoprotein L, 5, apolipoprotein L5, Apolipoprotein L-V, APOLV, APOL-V
Símbolos de los genes APOL5
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFV
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 80831
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.