missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein C-II/ApoC2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
193.00€ - 463.00€
Especificaciones
| Antígeno | Apolipoprotein C-II/ApoC2 |
|---|---|
| Dilución | Western Blot 1:100 - 1:500 |
| Aplicaciones | Western Blot |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18649190
|
Novus Biologicals
NBP2-92374-0.02ml |
0.02 mL |
193.00€
0.02 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18660731
|
Novus Biologicals
NBP2-92374-0.1ml |
0.1 mL |
463.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Apolipoprotein C-II/ApoC2 Polyclonal antibody specifically detects Apolipoprotein C-II/ApoC2 in Human, Rat samples. It is validated for Western BlotEspecificaciones
| Apolipoprotein C-II/ApoC2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS with 50% glycerol, pH7.3. | |
| 344 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| APC2, APOC2, Apo-CII, ApoC-II, Apolipoprotein C2, apolipoprotein C-II, MGC75082 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human APOC2 (NP_000474.2). MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto