missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ APOL3 Recombinant Protein Antigen

Código de producto. 18212682 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μl
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
18212682 100 μl 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18212682

Marca: Novus Biologicals™ NBP255075PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOL3. Source: E.coli Amino Acid Sequence: TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL The APOL3 Recombinant Protein Antigen is derived from E. coli. The APOL3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 80833
Método de purificación >80% by SDS-PAGE and Coomassie blue staining
Nombre común APOL3 Recombinant Protein Antigen
Contenido y almacenamiento −20°C, avoid freeze-thaw cycles
Formulación PBS and 1M Urea, pH 7.4
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Alias de gen apoL-III, APOLIII, apolipoprotein L, 3, apolipoprotein L3, Apolipoprotein L-III, CG12_1, CG121, CG12-1, TNF-inducible protein CG12-1
Símbolo de gen APOL3
Tipo de etiqueta Unlabeled
Tipo de producto Recombinant Protein Antigen
Cantidad 100 μl
Estado normativo RUO
Fuente E.coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51289. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mostrar más Mostrar menos

Para uso exclusivo en investigación.

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.