missing translation for 'onlineSavingsMsg'
Learn More

API5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-89326

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18213337

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock

Description

Description

API5 Polyclonal specifically detects API5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

API5
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
AAC-11API5L1, AAC11fibroblast growth factor 2-interacting factor 2, Antiapoptosis clone 11 protein, API-5, apoptosis inhibitor 5, Cell migration-inducing gene 8 protein, Fibroblast growth factor 2-interacting factor, FIF, migration-inducing protein MIG8, Protein XAGL
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
API5
This antibody was developed against Recombinant Protein corresponding to amino acids:TVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVN
0.1 mL
Apoptosis
8539
Human, Mouse, Rat
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

For Research Use Only