missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ AP1S1 (Human) Recombinant Protein
Human AP1S1 full-length ORF ( AAH03561, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00001174-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH
Especificaciones
| AAH03561 | |
| adaptor-related protein complex 1, sigma 1 subunit | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AP1S1 | |
| GST |
| 1174 | |
| Wheat germ expression system | |
| 25 μg | |
| AP19, CLAPS1, FLJ92436, SIGMA1A, WUGSC:H_DJ0747G18.2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |