missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ ANXA5 (Human) Recombinant Protein

Abnova™ ANXA5 (Human) Recombinant Protein

Código de producto. 16161621
Change view
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Código de producto. Cantidad unitSize
16161621 10 μg 10 microgramos
16171621 25 μg 25 microgramos
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16161621

Marca: Abnova™ H00000308P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Human ANXA5 full-length ORF ( AAH01429, 1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Spécification

Número de acceso AAH01429
ID de gen (Entrez) 308
Nombre annexin A5
Método de preparación Wheat germ expression system
Pruebas de control de calidad 125% SDS-PAGE Stained with Coomassie Blue
Cantidad 10 μg
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen ANX5, ENX2, PP4
Símbolo de gen ANXA5
Especie Wheat Germ (in vitro)
Etiqueta de proteína GST
Tampón 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.