missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. alpha-Defensin 1 Antibody - Azide and BSA Free, Novus Biologicals™

alpha-Defensin 1 Antibody - Azide and BSA Free, Novus Biologicals™

Código de producto. 18652598 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
20 μg
Tamaño de la unidad:
100 microlitros
20 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18652598 100 μg 100 microlitros
18605967 20 μg 20 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18652598 Proveedor Novus Biologicals N.º de proveedor NBP305562100ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

alpha-Defensin 1 Polyclonal antibody specifically detects alpha-Defensin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antígeno alpha-Defensin 1
Aplicaciones Western Blot, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulación PBS with 50% glycerol, pH7.3.
Alias de gen alpha 2, DEF1DEFA1B, DEFA2, defensin, alpha 1, myeloid-related sequence, defensin, alpha 1HP-1, HNP-1HP1, MRSMGC138393, myeloid-related sequence, neutrophil defensin 1
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 1-94 of human alpha-Defensin 1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Método de purificación Affinity purified
Cantidad 100 μg
Estado normativo RUO
Disciplina de investigación Apoptosis, Cancer, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 1667
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.