missing translation for 'onlineSavingsMsg'
Learn More

Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody, Novus Biologicals™

Código de producto. 18282892 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
18282892 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18282892

Marca: Novus Biologicals NBP169558

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Airway Trypsin-like Protease/HAT/TMPRSS11D Polyclonal specifically detects Airway Trypsin-like Protease/HAT/TMPRSS11D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Airway Trypsin-like Protease/HAT/TMPRSS11D
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen O60235
Alias de gen airway trypsin like protease, Airway trypsin-like protease, EC 3.4.21, EC 3.4.21.-, HAT, MGC150587, MGC150588, transmembrane protease serine 11D, transmembrane protease, serine 11D
Símbolos de los genes TMPRSS11D
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the middle region of TMPRSS11D. Peptide sequence IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC.
Peso molecular del antígeno 46 kDa
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 9407
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.