missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free, Novus Biologicals™
Tienda Bio Techne ProductosDescripción
Adenine Nucleotide Translocase 1/2/3/4 Polyclonal antibody specifically detects Adenine Nucleotide Translocase 1/2/3/4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | Adenine Nucleotide Translocase 1/2/3/4 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Formulación | PBS with 50% glycerol, pH7.3. |
| Alias de gen | 2F1, AAC1, AAC2, AAC3, AAC4, adenine nucleotide translocase 4, adenine nucleotide translocator 1 (skeletal muscle), adenine nucleotide translocator 2 (fibroblast), Adenine nucleotide translocator 3, Adenine nucleotide translocator 4, ADP,ATP carrier protein 1, ADP,ATP carrier protein 3, ADP,ATP carrier protein 4, ADP,ATP carrier protein, fibroblast isoform, ADP,ATP carrier protein, heart/skeletal muscle, ADP,ATP carrier protein, isoform T2, ADP,ATP carrier protein, liver, ADP/ATP translocase 1, ADP/ATP translocase 2, ADP/ATP translocase 3, ADP/ATP translocase 4, ADP/ATP translocator of liver, ANT, ANT 1, ANT 2, ANT 3, ANT 4, ANT1, ANT2, ANT3, ANT3Y, ANT4, epididymis secretory sperm binding protein, heart/skeletal muscle ATP/ADP translocator, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4, solute carr |
| Especie del huésped | Rabbit |
| Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2). GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV |
| Método de purificación | Affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?