missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
ADAMTS17 Polyclonal specifically detects ADAMTS17 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
Especificaciones
| Antígeno | ADAMTS17 |
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulación | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gen | A disintegrin and metalloproteinase with thrombospondin motifs 17, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 17, ADAM metallopeptidase with thrombospondin type 1 motif, 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, EC 3.4.24.82, FLJ16363, FLJ32769 |
| Símbolos de los genes | ADAMTS17 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS |
| Mostrar más |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?