missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
ADAMTS17 Polyclonal specifically detects ADAMTS17 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
Especificaciones
| Antígeno | ADAMTS17 |
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulación | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gen | A disintegrin and metalloproteinase with thrombospondin motifs 17, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 17, ADAM metallopeptidase with thrombospondin type 1 motif, 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, EC 3.4.24.82, FLJ16363, FLJ32769 |
| Símbolos de los genes | ADAMTS17 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS |
| Mostrar más |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?