missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
ADAMTS13 Polyclonal antibody specifically detects ADAMTS13 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | ADAMTS13 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulación | PBS (pH 7.2) and 40% Glycerol |
| Alias de gen | A disintegrin and metalloproteinase with thrombospondin motifs 13, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 13, ADAM metallopeptidase with thrombospondin type 1 motif, 13, ADAM-TS13, ADAMTS-13, DKFZp434C2322, EC 3.4.24.14, EC 3.4.24.82, EC 3.4.24.87, FLJ42993, MGC118899, MGC118900, TTPADAM-TS 13, vWF-cleaving protease, vWF-CPC9orf8, VWFCPvon Willebrand factor-cleaving protease |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the amino acids: AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV |
| Método de purificación | Immunogen affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?