missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABHD14A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Especificaciones
| Antígeno | ABHD14A |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18202581
|
Novus Biologicals
NBP2-58749 |
100 μL |
624.00€ 590.10€ / 100 microlitros Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18615647
|
Novus Biologicals
NBP2-58749-25ul |
25 μL |
415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
ABHD14A Polyclonal specifically detects ABHD14A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| ABHD14A | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| abhydrolase domain containing 14A, abhydrolase domain-containing protein 14A, DKFZp564O243, DORZ1, EC 3.-, FLJ60317, FLJ60467 | |
| ABHD14A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 25864 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit