missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABHD14A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-58749
Código de producto. 18202581
-
624.00€
590.10€ / 100 microlitros
Ahorro 33.90€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ABHD14A Polyclonal specifically detects ABHD14A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| ABHD14A | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| abhydrolase domain containing 14A, abhydrolase domain-containing protein 14A, DKFZp564O243, DORZ1, EC 3.-, FLJ60317, FLJ60467 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ABHD14A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP | |
| 100 μL | |
| Lipid and Metabolism | |
| 25864 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido