missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 18326147

HFE Antibody (1G12), Novus Biologicals™

Product Code. 18326147 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
0.1 mg
Unit Size:
0.01 miligramo
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18326147 0.1 mg 0.01 miligramo
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18326147 Supplier Novus Biologicals Supplier No. H00003077M01

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

HFE Monoclonal antibody specifically detects HFE in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antígeno HFE
Aplicaciones Western Blot, ELISA, Immunocytochemistry
Clasificación Monoclonal
Clon 1G12
Conjugado Unconjugated
Dilución Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulación In 1x PBS, pH 7.4
N.º de referencia del gen NP_000401
Alias de gen dJ221C16.10.1, hemochromatosis, hereditary hemochromatosis protein, hereditary hemochromatosis protein HLA-H, HH, high Fe, HLAH, HLA-HHFE1, MGC103790, MHC class I-like protein HFE, MVCD7
Especie del huésped Mouse
Inmunógeno HFE (NP_000401, 115 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
Método de purificación IgG purified
Cantidad 0.1 mg
Estado normativo RUO
Disciplina de investigación Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction, Stem Cells
Primario o secundario Primary
ID de gen (Entrez) 3077
Especies diana Human
Contenido y almacenamiento Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.