missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ ZP3 Polyclonal Antibody
GREENER_CHOICE

Código de producto. 16334905 Tienda Thermo Scientific Productos
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Código de producto. Cantidad unitSize
16334905 100 μg 100 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16334905

Marca: Invitrogen™ PA595637

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MCF-7 whole cell, human A549 whole cell, human Hela whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno ZP3
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 500 μg/mL
Conjugado Unconjugated
Formulación PBS with 4mg trehalose and 0.05mg sodium azide
génica ZP3
N.º de referencia del gen P21754
Alias de gen Processed zona pellucida sperm-binding protein 3; Sperm receptor; zona pellucida C; zona pellucida C protein; zona pellucida glycoprotein 3; zona pellucida glycoprotein 3 (sperm receptor); zona pellucida glycoprotein 3 preproprotein; zona pellucida glycoprotein 3A (sperm receptor); zona pellucida glycoprotein 3B; zona pellucida glycoprotein ZP3; zona pellucida glycoprotein ZP3B; zona pellucida protein C; Zona pellucida sperm-binding protein 3; Zp3; Zp-3; ZP3A; ZP3A/ZP3B; ZP3B; Zp-3B; ZPC
Símbolos de los genes ZP3
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence of human ZP3 (LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT).
Método de purificación Affinity chromatography
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 7784
Especies diana Human
Contenido y almacenamiento -20°C
Tipo de producto Antibody
Formulario Lyophilized
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.