missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SKAP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
211.00€ - 544.95€
Especificaciones
| Antígeno | SKAP |
|---|---|
| Dilución | Simple Western 1:20, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18432151
|
Novus Biologicals
NBP1-94007-25ul |
25 μL |
211.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18063477
|
Novus Biologicals
NBP1-94007 |
0.1 mL |
 577.00€ 544.95€ / 0.10 ml Ahorro 32.05€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
SKAP Polyclonal specifically detects SKAP in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Especificaciones
| SKAP | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 90417 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Simple Western 1:20, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C15orf23, chromosome 15 open reading frame 23, FLJ14502, HSD11, MGC141728, MGC141729, putative TRAF4-associated factor 1, SKAP, small kinetochore associated protein, TRAF4 associated factor 1, TRAF4AF1 | |
| KNSTRN | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto