missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SI Sucrase-Isomaltase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-62362
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
SI Sucrase-Isomaltase Polyclonal antibody specifically detects SI Sucrase-Isomaltase in Human samples. It is validated for Western Blot
Especificaciones
| SI Sucrase-Isomaltase | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| EC 3.2.1.20, MGC131621, MGC131622, oligosaccharide alpha-1,6-glucosidase, sucrase-isomaltase, sucrase-isomaltase (alpha-glucosidase), sucrase-isomaltase, intestinal | |
| Synthetic peptides corresponding to SI(sucrase-isomaltase (alpha-glucosidase)) The peptide sequence was selected form the middle region of SI. Peptide sequence LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| P14410 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6476 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction