missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ RAGE Monoclonal Antibody (5C6C1)
GREENER_CHOICE

Código de producto. 17931501
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Código de producto. Cantidad unitSize
17931501 100 μg 100 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 17931501

Marca: Invitrogen™ MA549253

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse and rat sequences by six amino acids. Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: mouse lung tissue, rat lung tissue, rat lung tissue. Flow: Jurkat cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The Receptor for Advanced Glycation End-products (RAGE) is a gene located on human chromosome 6p21.3, encoding a transmembrane receptor belonging to the immunoglobulin superfamily. RAGE is expressed in various tissues, with significant levels in the lungs, and plays a crucial role in cellular signaling and inflammation. As a receptor, RAGE binds multiple ligands, including advanced glycation end-products (AGEs), amyloid-beta peptide, high mobility group box 1 (HMGB1), and S100/calgranulin proteins, facilitating diverse pathological processes like inflammation, cancer progression, and neurodegeneration. The interaction between RAGE and its ligands triggers intracellular signaling pathways such as NF-kB activation, leading to inflammatory responses and oxidative stress. In the context of chronic diseases like diabetes, Alzheimer's, and cardiovascular diseases, RAGE is a critical mediator, linking metabolic disturbance to cellular dysfunction. Therapeutic targeting of RAGE signaling is under investigation, aiming to mitigate its contribution to inflammatory and degenerative diseases.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno RAGE
Aplicaciones Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Clasificación Monoclonal
Clon 5C6C1
Concentración 500 μg/mL
Conjugado Unconjugated
Formulación PBS with 4mg trehalose and no preservative
génica AGER
N.º de referencia del gen Q15109, Q62151, Q63495
Alias de gen advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Símbolos de los genes AGER
Especie del huésped Mouse
Inmunógeno A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
Método de purificación Antigen affinity chromatography
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 11596, 177, 81722
Especies diana Human, Mouse, Rat
Contenido y almacenamiento -20°C
Tipo de producto Antibody
Formulario Lyophilized
Isotype IgG2b
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.