missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBC1D30 Rabbit anti-Human, Polyclonal Antibody, Abnova™
Descrizione
Sequence: NSSPVINHLLLGKKMKMTNRAAKNAVIHIPGHTGGKISPVPYEDLKTKLNSPWRTHIRVHKKNMPRTKSHPGCGDTVGLIDEQNEASKTNGLG
Specifica
Specifica
| Antígeno | TBC1D30 |
| Aplicaciones | Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Descripción | Rabbit polyclonal antibody raised against recombinant TBC1D30. |
| Dilución | Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Formulación | In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide) |
| génica | TBC1D30 |
| Alias de gen | KIAA0984 |
| Símbolos de los genes | TBC1D30 |
| Vedi altri risultati |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?