missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16106690

C14orf100, Rabbit, Polyclonal Antibody, Abnova™

Código de producto. 16106690
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16106690 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16106690 Proveedor Abnova N.º de proveedor PAB28315.100uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit polyclonal antibody raised against recombinant C14orf100.

Sequence: LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH

Spécification

Antígeno C14orf100
Aplicaciones Immunohistochemistry (PFA fixed)
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Rabbit polyclonal antibody raised against recombinant C14orf100.
Dilución Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
Formulación In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
génica C14orf100
Alias de gen CDA06/HSPC213/HSPC327/JAMP
Símbolos de los genes C14orf100
Especie del huésped Rabbit
Inmunógeno Recombinant protein corresponding to amino acids of recombinant C14orf100.
Método de purificación Antigen affinity purification
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 51528
Especies diana Human
Contenido y almacenamiento Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Formulario Liquid
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.