missing translation for 'onlineSavingsMsg'
Learn More

ACE Rabbit anti-Human, Polyclonal Antibody, Abnova™

Código de producto. 16166430
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
16166430 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16166430

Marca: Abnova PAB27843.100uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit polyclonal antibody raised against recombinant ACE.

This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes - the somatic form and the testicular form that are equally active. Multiple additional alternatively spliced variants have been identified but their full length nature has not been determined. [provided by RefSeq

Sequence: KFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWE

Especificaciones

Antígeno ACE
Aplicaciones Immunohistochemistry (PFA fixed)
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Rabbit polyclonal antibody raised against recombinant ACE.
Dilución Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Formulación In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
génica ACE
Alias de gen ACE1/CD143/DCP/DCP1/MGC26566
Símbolos de los genes ACE
Especie del huésped Rabbit
Inmunógeno Recombinant protein corresponding to amino acids of human ACE.
Método de purificación Antigen affinity purification
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 1636
Especies diana Human
Contenido y almacenamiento Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Formulario Liquid
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.