PHF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

292.00€ - 518.70€

Especificaciones

Antígeno	PHF1
Dilución	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Aplicaciones	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación	Polyclonal
Conjugado	Unconjugated

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Price	Quantity & Availability
18472221 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-82613-25ul	25 μL	292.00€ 25 microlitros View alternative products Save Up to »		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

18272286 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-82613	0.1 mL	549.00€ 518.70€ / 0.10 ml Ahorro 30.30€ 5% Descuento View alternative products Save Up to »		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Description

PHF1 Polyclonal specifically detects PHF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antígeno	PHF1
Aplicaciones	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugado	Unconjugated
Estado normativo	RUO
Formulación	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
ID de gen (Entrez)	5252
Inmunógeno	This antibody was developed against Recombinant Protein corresponding to amino acids:ACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGERSSKLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS
Primario o secundario	Primary
Contenido y almacenamiento	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilución	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Clasificación	Polyclonal
Especie del huésped	Rabbit
Especies diana	Human
Alias de gen	hPCl1, MTF2L2, PCL1, PHD finger protein 1, PHF2, Polycomb-like protein 1, Protein PHF1
Símbolos de los genes	PHF1
Isotype	IgG
Método de purificación	Affinity Purified
Especificidad de la prueba	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

PHF1 Antibody, Novus Biologicals™

Especificaciones

Description

Specifications

Documents