missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDGF-D/SCDGFB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Especificaciones
| Antígeno | PDGF-D/SCDGFB |
|---|---|
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18603346
|
Novus Biologicals
NBP2-38087-25ul |
25 μL |
 415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18169178
|
Novus Biologicals
NBP2-38087 |
0.1 mL |
624.00€ 590.10€ / 0.10 ml Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
PDGF-D/SCDGFB Polyclonal specifically detects PDGF-D/SCDGFB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| PDGF-D/SCDGFB | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9GZP0 | |
| 80310 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IEGFMSTP036, Iris-expressed growth factor, PDGF-D, platelet derived growth factor D, SCDGF-BMGC26867, SCDGFBplatelet-derived growth factor D, spinal cord derived growth factor B, Spinal cord-derived growth factor B, spinal cord-derived growth factor-B | |
| PDGFD | |
| IgG | |
| Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto