missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pax2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 560.70€
Especificaciones
| Antígeno | Pax2 |
|---|---|
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18487321
|
Novus Biologicals
NBP2-33496-25ul |
25 μL |
369.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18789253
|
Novus Biologicals
NBP2-33496 |
593.00€ 560.70€ / 0.10 ml Ahorro 32.30€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||||
Descripción
Pax2 Polyclonal specifically detects Pax2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| Pax2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q02962 | |
| 5076 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Neuronal Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| paired box 2, paired box gene 2, paired box homeotic gene 2, paired box protein Pax-2 | |
| PAX2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto