missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ OGT Polyclonal Antibody
GREENER_CHOICE

Código de producto. 16364585 Tienda Thermo Scientific Productos
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16364585 100 μg 100 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16364585 Proveedor Invitrogen™ N.º de proveedor PA595319

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human PC-3 whole cell, human A431 whole cell, human A549 whole cell, human Caco-2 whole cell, human K562 whole cell, rat heart tissue, mouse heart tissue. IHC: mouse intestine tissue, rat intestine tissue, human gastric cancer tissue, human pancreatic cancer tissue, rat pancreas tissue. ICC/IF: A431 cell. Flow: U937 cell, RAW2647 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno OGT
Aplicaciones Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Clasificación Polyclonal
Concentración 500 μg/mL
Conjugado Unconjugated
Formulación PBS with 5mg BSA and 0.05mg sodium azide
génica OGT
N.º de referencia del gen O15294, P56558, Q8CGY8
Alias de gen 1110038P24Rik; 4831420N21Rik; AI115525; FLJ23071; HINCUT-1; HRNT1; MGC22921; O linked N-acetylglucosamine transferase; O-GLCNAC; o-glcnac transferase; O-GlcNAc transferase p110 subunit; O-GlcNAc transferase subunit p110; OGT; Ogtl; O-linked N-acetylglucosamine (GlcNAc) transferase; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); O-linked N-acetylglucosamine transferase; O-linked N-acetylglucosamine transferase 110 kDa subunit; UDP-N-acetylglucosamine:polypeptide-N- acetylglucosaminyl transferase; UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase
Símbolos de los genes OGT
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA).
Método de purificación Affinity chromatography
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 108155, 26295, 8473
Especies diana Human, Mouse, Rat
Contenido y almacenamiento -20°C
Tipo de producto Antibody
Formulario Lyophilized
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.