missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16189486

P53AIP1, Mouse, Polyclonal Antibody, Abnova™

Product Code. 16189486
Change view
Click to view available options
Cantidad:
50 μL
Unit Size:
50 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
16189486 50 μL 50 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16189486 Supplier Abnova Supplier No. H00063970A01.50uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a partial recombinant P53AIP1.

Sequence: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN

Specifications

Antígeno P53AIP1
Aplicaciones ELISA, Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a partial recombinant P53AIP1.
Formulación 50% glycerol
génica P53AIP1
N.º de referencia del gen NM_022112
Símbolos de los genes P53AIP1
Especie del huésped Mouse
Inmunógeno P53AIP1 (NP_071395, 1 a.a. ∽ 108 a.a) partial recombinant protein with GST tag.
Cantidad 50 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 63970
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Formulario Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.