missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16166011

HBG1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Código de producto. 16166011
Change view
Click to view available options
Cantidad:
50 μL
Tamaño de la unidad:
50 microlitros
Código de producto. Cantidad unitSize
16166011 50 μL 50 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16166011

Marca: Abnova H00003047A01.50uL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse polyclonal antibody raised against a full-length recombinant HBG1.

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq]

Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAVMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Especificaciones

Antígeno HBG1
Aplicaciones ELISA
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a full-length recombinant HBG1.
Formulación 50% glycerol
génica HBG1
N.º de referencia del gen BC010913
Alias de gen HBGA/HBGR/HSGGL1/PRO2979
Símbolos de los genes HBG1
Especie del huésped Mouse
Inmunógeno HBG1 (AAH10913, 1 a.a. ∽ 147 a.a) full-length recombinant protein with GST tag.
Cantidad 50 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 3047
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Formulario Antisera
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.