missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MCM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-33954
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
MCM2 Polyclonal specifically detects MCM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| MCM2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P49736 | |
| MCM2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQD | |
| 0.1 mL | |
| Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers | |
| 4171 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BM28MGC10606, CCNL 1, CCNL1, CDCL1mitotin, EC 3.6.4.12, KIAA0030MITOTIN, MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae), minichromosome maintenance complex component 2, minichromosome maintenance deficient (S. cerevisiae) 2 (mitotin), minichromosome maintenance deficient 2 (mitotin) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido