missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16122326

MARCH6, Mouse anti-Human, Clone: 1A5, Abnova™

Código de producto. 16122326
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16122326 100 μg 100 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16122326 Proveedor Abnova N.º de proveedor H00010299M05.100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse Monoclonal Antibody

Sequence: DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR

Especificaciones

Antígeno MARCH6
Aplicaciones ELISA, Western Blot
Clasificación Monoclonal
Clon 1A5
Conjugado Unconjugated
Formulación In 1x PBS, pH 7.4
génica membrane-associated ring finger (C3HC4) 6
N.º de referencia del gen NM_005885
Alias de gen KIAA0597/MARCH-VI/RNF176/TEB4
Símbolos de los genes MARCH6
Especie del huésped Mouse
Inmunógeno MARCH6 (NP_005876, 2 a.a. ∼ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 10299
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG2b κ
Mostrar más Mostrar menos
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.